| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries) |
| Domain d3gkza1: 3gkz A:9-116 [210570] automated match to d1qoka1 complexed with b40 |
PDB Entry: 3gkz (more details), 1.9 Å
SCOPe Domain Sequences for d3gkza1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gkza1 b.1.1.0 (A:9-116) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlqesgpslvkpsqtlsltcsvtgdsvtsgywswirqfpgnkldymgyisyrgstyyn
pslksrisitrdtsknqvylqlksvssedtatyycsyfdsddyameyw
Timeline for d3gkza1: