![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (7 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88576] (391 PDB entries) Uniprot P01864 # GCAB_MOUSE Ig gamma-2A chain C region secreted form (B allele) ! Uniprot P01863 #GCAA_MOUSE Ig gamma-2A chain C region, A allele; 86% sequence identity ! SQ NA # natural chimera; best hits are: Uniprot P01751 (Ig heavy chain V region B1-8/186-2) and Uniprot P01864 (Ig gamma-2A chain C region secreted form) ! Uniprot P01868 # GC1_MOUSE Ig gamma-1 chain C region secreted form ! Uniprot P01864 # GCAB_MOUSE (P01864) Ig gamma-2A chain C region ! Uniprot P01837 # KAC_MOUSE (P01837) Ig kappa chain C region ! Uniprot P01863 # GCAA_MOUSE Ig gamma-2A chain C region, A allele ! SQ NA # part of Fab 28 against HIV-1 RT ! Uniprot P01868 # ! GC1_MOUSE Ig gamma-1 chain C region secreted form |
![]() | Domain d2gfbl2: 2gfb L:120-227 [21057] Other proteins in same PDB: d2gfba1, d2gfba2, d2gfbb1, d2gfbc1, d2gfbc2, d2gfbd1, d2gfbe1, d2gfbe2, d2gfbf1, d2gfbg1, d2gfbg2, d2gfbh1, d2gfbi1, d2gfbi2, d2gfbj1, d2gfbk1, d2gfbk2, d2gfbl1, d2gfbm1, d2gfbm2, d2gfbn1, d2gfbo1, d2gfbo2, d2gfbp1 part of Fab CNJ206; H-chains in this entry seem to be mistraced in VH region |
PDB Entry: 2gfb (more details), 3 Å
SCOPe Domain Sequences for d2gfbl2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gfbl2 b.1.1.2 (L:120-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss svtvtsstwpsqsitcnvahpasstkvdkkieprg
Timeline for d2gfbl2:
![]() Domains from other chains: (mouse over for more information) d2gfba1, d2gfba2, d2gfbb1, d2gfbb2, d2gfbc1, d2gfbc2, d2gfbd1, d2gfbd2, d2gfbe1, d2gfbe2, d2gfbf1, d2gfbf2, d2gfbg1, d2gfbg2, d2gfbh1, d2gfbh2, d2gfbi1, d2gfbi2, d2gfbj1, d2gfbj2, d2gfbk1, d2gfbk2, d2gfbm1, d2gfbm2, d2gfbn1, d2gfbn2, d2gfbo1, d2gfbo2, d2gfbp1, d2gfbp2 |