SCOPe 2.08: Domain d3gk8l2: 3gk8 L:108-214

Lineage for d3gk8l2 (3gk8 L:108-214)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d3gk8l2: 3gk8 L:108-214 [210565]
   Other proteins in same PDB: d3gk8h_
   automated match to d1c12a2

Details for d3gk8l2

PDB Entry: 3gk8, 2 Å

PDB Description: x-ray crystal structure of the fab from mab 14, mouse antibody against canine parvovirus

PDB Compounds: (L:) Fab 14 Light Chain

SCOPe Domain Sequences for d3gk8l2:

Sequence; same for both SEQRES and ATOM records:

>d3gk8l2 b.1.1.0 (L:108-214) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwaidgaeraggvlnsftgqd
skdstysmsstltltkdeyerhasytceathktstapivksfnrgaa

Timeline for d3gk8l2:

• d3gk8l2 first appeared in SCOPe 2.03
  
• d3gk8l2 appears in SCOPe 2.07