Lineage for d3gk3b_ (3gk3 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (238 species)
    not a true protein
  7. 2094636Species Burkholderia pseudomallei [TaxId:320372] [188646] (7 PDB entries)
  8. 2094651Domain d3gk3b_: 3gk3 B: [210561]
    automated match to d3uf0a_
    complexed with po4

Details for d3gk3b_

PDB Entry: 3gk3 (more details), 2.1 Å

PDB Description: Crystal structure of acetoacetyl-CoA reductase from Burkholderia pseudomallei 1710b
PDB Compounds: (B:) Acetoacetyl-CoA reductase

SCOPe Domain Sequences for d3gk3b_:

Sequence, based on SEQRES records: (download)

>d3gk3b_ c.2.1.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
akrvafvtggmgglgaaisrrlhdagmavavshserndhvstwlmherdagrdfkayavd
vadfescercaekvladfgkvdvlinnagitrdatfmkmtkgdwdavmrtdldamfnvtk
qfiagmverrfgrivnigsvngsrgafgqanyasakagihgftktlaletakrgitvntv
spgylatamveavpqdvleakilpqipvgrlgrpdevaaliaflcsddagfvtgadlain
ggmhms

Sequence, based on observed residues (ATOM records): (download)

>d3gk3b_ c.2.1.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
akrvafvtggmgglgaaisrrlhdagmavavshsdhvstwlmherdagrdfkayavdvad
fescercaekvladfgkvdvlinnagitrdatfmkmtkgdwdavmrtdldamfnvtkqfi
agmverrfgrivnigsvngsrgafgqanyasakagihgftktlaletakrgitvntvspg
ylatamveavpqdvleakilpqipvgrlgrpdevaaliaflcsddagfvtgadlainggm
hms

SCOPe Domain Coordinates for d3gk3b_:

Click to download the PDB-style file with coordinates for d3gk3b_.
(The format of our PDB-style files is described here.)

Timeline for d3gk3b_: