Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) |
Family c.1.24.0: automated matches [191640] (1 protein) not a true family |
Protein automated matches [191177] (2 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:320372] [225631] (1 PDB entry) |
Domain d3gk0f_: 3gk0 F: [210557] automated match to d3o6ca_ complexed with dxp, po4 |
PDB Entry: 3gk0 (more details), 2.28 Å
SCOPe Domain Sequences for d3gk0f_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gk0f_ c.1.24.0 (F:) automated matches {Burkholderia pseudomallei [TaxId: 320372]} aidlgvnidhvatlrnargtaypdpvraalaaedagadaitlhlredrrhivdadvrtlr prvktrmnlecavtpemldiaceirphdaclvpekrseltteggldvvghfdavraackq ladagvrvslfidpdeaqiraahetgapvielhtgryadahdaaeqqreferiatgvdag ialglkvnaghglhytnvqaiaalpgiaelnighaivahavfvgwdnavremkaimvaar vaal
Timeline for d3gk0f_: