Lineage for d3gk0f_ (3gk0 F:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1336838Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1346158Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) (S)
  5. 1346204Family c.1.24.0: automated matches [191640] (1 protein)
    not a true family
  6. 1346205Protein automated matches [191177] (2 species)
    not a true protein
  7. 1346206Species Burkholderia pseudomallei [TaxId:320372] [225631] (1 PDB entry)
  8. 1346212Domain d3gk0f_: 3gk0 F: [210557]
    automated match to d3o6ca_
    complexed with dxp, po4

Details for d3gk0f_

PDB Entry: 3gk0 (more details), 2.28 Å

PDB Description: crystal structure of pyridoxal phosphate biosynthetic protein from burkholderia pseudomallei
PDB Compounds: (F:) pyridoxine 5'-phosphate synthase

SCOPe Domain Sequences for d3gk0f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gk0f_ c.1.24.0 (F:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
aidlgvnidhvatlrnargtaypdpvraalaaedagadaitlhlredrrhivdadvrtlr
prvktrmnlecavtpemldiaceirphdaclvpekrseltteggldvvghfdavraackq
ladagvrvslfidpdeaqiraahetgapvielhtgryadahdaaeqqreferiatgvdag
ialglkvnaghglhytnvqaiaalpgiaelnighaivahavfvgwdnavremkaimvaar
vaal

SCOPe Domain Coordinates for d3gk0f_:

Click to download the PDB-style file with coordinates for d3gk0f_.
(The format of our PDB-style files is described here.)

Timeline for d3gk0f_: