Lineage for d3gk0e_ (3gk0 E:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840720Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) (S)
  5. 2840771Family c.1.24.0: automated matches [191640] (1 protein)
    not a true family
  6. 2840772Protein automated matches [191177] (4 species)
    not a true protein
  7. 2840773Species Burkholderia pseudomallei [TaxId:320372] [225631] (1 PDB entry)
  8. 2840778Domain d3gk0e_: 3gk0 E: [210556]
    automated match to d3o6ca_
    complexed with dxp, po4

Details for d3gk0e_

PDB Entry: 3gk0 (more details), 2.28 Å

PDB Description: crystal structure of pyridoxal phosphate biosynthetic protein from burkholderia pseudomallei
PDB Compounds: (E:) pyridoxine 5'-phosphate synthase

SCOPe Domain Sequences for d3gk0e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gk0e_ c.1.24.0 (E:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
aidlgvnidhvatlrnargtaypdpvraalaaedagadaitlhlredrrhivdadvrtlr
prvktrmnlecavtpemldiaceirphdaclvpekrseltteggldvvghfdavraackq
ladagvrvslfidpdeaqiraahetgapvielhtgryadahdaaeqqreferiatgvdag
ialglkvnaghglhytnvqaiaalpgiaelnighaivahavfvgwdnavremkaimvaar
vaalh

SCOPe Domain Coordinates for d3gk0e_:

Click to download the PDB-style file with coordinates for d3gk0e_.
(The format of our PDB-style files is described here.)

Timeline for d3gk0e_: