Lineage for d3gk0d_ (3gk0 D:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2102338Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) (S)
  5. 2102384Family c.1.24.0: automated matches [191640] (1 protein)
    not a true family
  6. 2102385Protein automated matches [191177] (3 species)
    not a true protein
  7. 2102386Species Burkholderia pseudomallei [TaxId:320372] [225631] (1 PDB entry)
  8. 2102390Domain d3gk0d_: 3gk0 D: [210555]
    automated match to d3o6ca_
    complexed with dxp, po4

Details for d3gk0d_

PDB Entry: 3gk0 (more details), 2.28 Å

PDB Description: crystal structure of pyridoxal phosphate biosynthetic protein from burkholderia pseudomallei
PDB Compounds: (D:) pyridoxine 5'-phosphate synthase

SCOPe Domain Sequences for d3gk0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gk0d_ c.1.24.0 (D:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
aaidlgvnidhvatlrnargtaypdpvraalaaedagadaitlhlredrrhivdadvrtl
rprvktrmnlecavtpemldiaceirphdaclvpekrseltteggldvvghfdavraack
qladagvrvslfidpdeaqiraahetgapvielhtgryadahdaaeqqreferiatgvda
gialglkvnaghglhytnvqaiaalpgiaelnighaivahavfvgwdnavremkaimvaa
rvaalh

SCOPe Domain Coordinates for d3gk0d_:

Click to download the PDB-style file with coordinates for d3gk0d_.
(The format of our PDB-style files is described here.)

Timeline for d3gk0d_: