| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) ![]() |
| Family c.1.24.0: automated matches [191640] (1 protein) not a true family |
| Protein automated matches [191177] (4 species) not a true protein |
| Species Burkholderia pseudomallei [TaxId:320372] [225631] (1 PDB entry) |
| Domain d3gk0d_: 3gk0 D: [210555] automated match to d3o6ca_ complexed with dxp, po4 |
PDB Entry: 3gk0 (more details), 2.28 Å
SCOPe Domain Sequences for d3gk0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gk0d_ c.1.24.0 (D:) automated matches {Burkholderia pseudomallei [TaxId: 320372]}
aaidlgvnidhvatlrnargtaypdpvraalaaedagadaitlhlredrrhivdadvrtl
rprvktrmnlecavtpemldiaceirphdaclvpekrseltteggldvvghfdavraack
qladagvrvslfidpdeaqiraahetgapvielhtgryadahdaaeqqreferiatgvda
gialglkvnaghglhytnvqaiaalpgiaelnighaivahavfvgwdnavremkaimvaa
rvaalh
Timeline for d3gk0d_: