Lineage for d3giya_ (3giy A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080389Protein automated matches [190228] (18 species)
    not a true protein
  7. 2080469Species Pseudomonas putida [TaxId:303] [225091] (4 PDB entries)
  8. 2080470Domain d3giya_: 3giy A: [210543]
    automated match to d1p4ca_
    complexed with fmn, mes; mutant

Details for d3giya_

PDB Entry: 3giy (more details), 1.6 Å

PDB Description: crystal structures of the g81a mutant of the active chimera of (s)- mandelate dehydrogenase and its complex with two of its substrates
PDB Compounds: (A:) (S)-mandelate dehydrogenase, Peroxisomal (S)-2-hydroxy-acid oxidase

SCOPe Domain Sequences for d3giya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3giya_ c.1.4.1 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
nlfnvedyrklaqkrlpkmvydyleggaedeygvkhnrdvfqqwrfkpkrlvdvsrrslq
aevlgkrqsmplligptalngalwpkgdlalaraatkagipfvlstasnmsiedlarqcd
gdlwfqlyvihreiaqgmvlkalhtgyttlvlttdvavngyrerdlhnrfkippfltlkn
fegidlgkmdkanlemqaalmsrqmdasfnwealrwlrdlwphkllvkgllsaedadrci
aegadgvilsnhggrqldcaispmevlaqsvaktgkpvlidsgfrrgsdivkalalgaea
vllgratlyglaargetgvdevltllkadidrtlaqigcpditslspdylqne

SCOPe Domain Coordinates for d3giya_:

Click to download the PDB-style file with coordinates for d3giya_.
(The format of our PDB-style files is described here.)

Timeline for d3giya_: