SCOPe 2.05: Domain d3ginb_: 3gin B:

Lineage for d3ginb_ (3gin B:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.27: CalX-like [141072] (2 families)

5. Family b.1.27.1: CalX-beta domain [141073] (2 proteins)
   Pfam PF03160

6. Protein automated matches [227001] (3 species)
   not a true protein

7. Species Canis lupus [TaxId:9615] [225646] (1 PDB entry)

8. Domain d3ginb_: 3gin B: [210542]
   automated match to d2dpka1
   complexed with ca

Details for d3ginb_

PDB Entry: 3gin, 2.4 Å

PDB Description: crystal structure of e454k-cbd1

PDB Compounds: (B:) Sodium/calcium exchanger 1

SCOPe Domain Sequences for d3ginb_:

Sequence, based on SEQRES records:

>d3ginb_ b.1.27.1 (B:) automated matches {Canis lupus [TaxId: 9615]}
pvskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtanagsdyeftegtv
vfkpgetqkeirvgiidddifeedknflvhlsnvkvsseasedgileanhvsalaclgsp
statvtifdddh

Sequence, based on observed residues (ATOM records):

>d3ginb_ b.1.27.1 (B:) automated matches {Canis lupus [TaxId: 9615]}
pvskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtanagsdyeftegtv
vfkpgetqkeirvgiidddifeedknflvhlsnvkvslaclgspstatvtifdddh

Timeline for d3ginb_:

• d3ginb_ first appeared in SCOPe 2.03
  
• d3ginb_ appears in SCOPe 2.04
  
• d3ginb_ appears in SCOPe 2.06
  
• d3ginb_ appears in the current release, SCOPe 2.08