Lineage for d3ginb_ (3gin B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2344608Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2363222Superfamily b.1.27: CalX-like [141072] (2 families) (S)
  5. 2363223Family b.1.27.1: CalX-beta domain [141073] (2 proteins)
    Pfam PF03160
  6. 2363229Protein automated matches [227001] (3 species)
    not a true protein
  7. 2363230Species Canis lupus [TaxId:9615] [225646] (1 PDB entry)
  8. 2363232Domain d3ginb_: 3gin B: [210542]
    automated match to d2dpka1
    complexed with ca

Details for d3ginb_

PDB Entry: 3gin (more details), 2.4 Å

PDB Description: Crystal structure of E454K-CBD1
PDB Compounds: (B:) Sodium/calcium exchanger 1

SCOPe Domain Sequences for d3ginb_:

Sequence, based on SEQRES records: (download)

>d3ginb_ b.1.27.1 (B:) automated matches {Canis lupus [TaxId: 9615]}
pvskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtanagsdyeftegtv
vfkpgetqkeirvgiidddifeedknflvhlsnvkvsseasedgileanhvsalaclgsp
statvtifdddh

Sequence, based on observed residues (ATOM records): (download)

>d3ginb_ b.1.27.1 (B:) automated matches {Canis lupus [TaxId: 9615]}
pvskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtanagsdyeftegtv
vfkpgetqkeirvgiidddifeedknflvhlsnvkvslaclgspstatvtifdddh

SCOPe Domain Coordinates for d3ginb_:

Click to download the PDB-style file with coordinates for d3ginb_.
(The format of our PDB-style files is described here.)

Timeline for d3ginb_: