Lineage for d3gina_ (3gin A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1300448Superfamily b.1.27: CalX-like [141072] (2 families) (S)
  5. 1300449Family b.1.27.1: CalX-beta domain [141073] (2 proteins)
    Pfam PF03160
  6. 1300455Protein automated matches [227001] (1 species)
    not a true protein
  7. 1300456Species Canis lupus [TaxId:9615] [225646] (1 PDB entry)
  8. 1300457Domain d3gina_: 3gin A: [210541]
    automated match to d2dpka1
    complexed with ca

Details for d3gina_

PDB Entry: 3gin (more details), 2.4 Å

PDB Description: crystal structure of e454k-cbd1
PDB Compounds: (A:) Sodium/calcium exchanger 1

SCOPe Domain Sequences for d3gina_:

Sequence, based on SEQRES records: (download)

>d3gina_ b.1.27.1 (A:) automated matches {Canis lupus [TaxId: 9615]}
pvskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtanagsdyeftegtv
vfkpgetqkeirvgiidddifeedknflvhlsnvkvsseasedgileanhvsalaclgsp
statvtifdddh

Sequence, based on observed residues (ATOM records): (download)

>d3gina_ b.1.27.1 (A:) automated matches {Canis lupus [TaxId: 9615]}
pvskiffeqgtyqclencgtvaltiirrggdltntvfvdfrtedgtanagsdyeftegtv
vfkpgetqkeirvgiidddifeedknflvhlsnvkvalaclgspstatvtifdddh

SCOPe Domain Coordinates for d3gina_:

Click to download the PDB-style file with coordinates for d3gina_.
(The format of our PDB-style files is described here.)

Timeline for d3gina_: