Lineage for d3gg6a_ (3gg6 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2971307Fold d.113: Nudix [55810] (1 superfamily)
    beta(2)-alpha-beta(3)-alpha; 3 layers: alpha/beta/alpha; mixed sheet
    contains beta-grasp motif
  4. 2971308Superfamily d.113.1: Nudix [55811] (8 families) (S)
  5. 2971788Family d.113.1.0: automated matches [191580] (1 protein)
    not a true family
  6. 2971789Protein automated matches [191036] (17 species)
    not a true protein
  7. 2971879Species Human (Homo sapiens) [TaxId:9606] [225626] (39 PDB entries)
  8. 2971883Domain d3gg6a_: 3gg6 A: [210527]
    automated match to d2b0va1

Details for d3gg6a_

PDB Entry: 3gg6 (more details), 2.1 Å

PDB Description: Crystal structure of the NUDIX domain of human NUDT18
PDB Compounds: (A:) Nucleoside diphosphate-linked moiety X motif 18

SCOPe Domain Sequences for d3gg6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gg6a_ d.113.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vrlrknvcyvvlavflseqdevlliqeakrecrgswylpagrmepgetivealqrevkee
aglhcepetllsveergpswvrfvflarptggilktskeadaeslqaawyprtslptplr
ahdilhlvelaaqyrqqarhplil

SCOPe Domain Coordinates for d3gg6a_:

Click to download the PDB-style file with coordinates for d3gg6a_.
(The format of our PDB-style files is described here.)

Timeline for d3gg6a_: