Lineage for d2gfbg2 (2gfb G:109-214)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8860Species Fab CNJ206 (mouse), kappa L chain [49012] (2 PDB entries)
  8. 8867Domain d2gfbg2: 2gfb G:109-214 [21052]
    Other proteins in same PDB: d2gfba1, d2gfbb1, d2gfbc1, d2gfbd1, d2gfbe1, d2gfbf1, d2gfbg1, d2gfbh1, d2gfbi1, d2gfbj1, d2gfbk1, d2gfbl1, d2gfbm1, d2gfbn1, d2gfbo1, d2gfbp1

Details for d2gfbg2

PDB Entry: 2gfb (more details), 3 Å

PDB Description: crystal structure of a catalytic fab having esterase-like activity

SCOP Domain Sequences for d2gfbg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2gfbg2 b.1.1.2 (G:109-214) Immunoglobulin (constant domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain}
ggaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d2gfbg2:

Click to download the PDB-style file with coordinates for d2gfbg2.
(The format of our PDB-style files is described here.)

Timeline for d2gfbg2: