Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.14: ClpP/crotonase [52095] (1 superfamily) core: 4 turns of (beta-beta-alpha)n superhelix |
Superfamily c.14.1: ClpP/crotonase [52096] (5 families) |
Family c.14.1.4: Biotin dependent carboxylase carboxyltransferase domain [89572] (9 proteins) Pfam PF01039 the active site is formed by two different homologous subunits or domains of this fold |
Protein Glutaconyl-CoA decarboxylase A subunit, N-terminal domain [418958] (2 species) |
Species Clostridium symbiosum [TaxId:1512] [419420] (4 PDB entries) |
Domain d3gf3a1: 3gf3 A:3-291 [210518] Other proteins in same PDB: d3gf3a2 automated match to d1pixa2 complexed with cl, coo has additional insertions and/or extensions that are not grouped together |
PDB Entry: 3gf3 (more details), 1.75 Å
SCOPe Domain Sequences for d3gf3a1:
Sequence, based on SEQRES records: (download)
>d3gf3a1 c.14.1.4 (A:3-291) Glutaconyl-CoA decarboxylase A subunit, N-terminal domain {Clostridium symbiosum [TaxId: 1512]} mysmpgyfqnmptigkelvnpnpeneqeikavesdihesikkaldagitseeklnergql samqrinalidpgtwcplnslfnpennkfgttnivnglgrvdgkwvyivasdnkkmagaw vpgqaenlircsdaakmmhlpliyllncsgvefpnqdkvypnrrgggtpffrnselnqlg ipvivgiygtnpagggyhsisptiliahqdanmavggagilsgmnpkgyiddeaaeqiia aqiensklkvpapgsvpihydetgffrevyqndlgvidgikkyisylpa
>d3gf3a1 c.14.1.4 (A:3-291) Glutaconyl-CoA decarboxylase A subunit, N-terminal domain {Clostridium symbiosum [TaxId: 1512]} mysmpgyfqnmptigkelvnpnpeneqeikavesdihesikkaldagitseeklnergql samqrinalidpgtwcplnslfnpennkfgttnivnglgrvdgkwvyivasdnkkmagaw vpgqaenlircsdaakmmhlpliyllncsgvefpnqdkvypnrrgggtpffrnselnqlg ipvivgiygtnpagggyhsisptiliahqdanmavggagaeqiiaaqiensklkvpapgs vpihydetgffrevyqndlgvidgikkyisylpa
Timeline for d3gf3a1: