Class b: All beta proteins [48724] (174 folds) |
Fold b.85: beta-clip [51268] (7 superfamilies) double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll |
Superfamily b.85.4: dUTPase-like [51283] (2 families) forms tight trimer through an additional beta-sheet in each subunit subunit beta-sheets are orthogonally packed around the three-fold axis |
Family b.85.4.1: dUTPase-like [51284] (5 proteins) |
Protein automated matches [190798] (8 species) not a true protein |
Species Methanocaldococcus jannaschii [TaxId:2190] [226814] (1 PDB entry) |
Domain d3gf0a_: 3gf0 A: [210517] automated match to d1pkha_ complexed with mg, pop; mutant |
PDB Entry: 3gf0 (more details), 2.62 Å
SCOPe Domain Sequences for d3gf0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gf0a_ b.85.4.1 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]} milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl grvfltshqtagwidagfkgkitlqivafdkpvilyknqrigqlifskllspadvgyser ktskyayqksvmpslihld
Timeline for d3gf0a_: