Lineage for d3gf0a_ (3gf0 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1332308Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1332444Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1332445Family b.85.4.1: dUTPase-like [51284] (5 proteins)
  6. 1332599Protein automated matches [190798] (8 species)
    not a true protein
  7. 1332615Species Methanocaldococcus jannaschii [TaxId:2190] [226814] (1 PDB entry)
  8. 1332616Domain d3gf0a_: 3gf0 A: [210517]
    automated match to d1pkha_
    complexed with mg, pop; mutant

Details for d3gf0a_

PDB Entry: 3gf0 (more details), 2.62 Å

PDB Description: bifunctional dctp deaminase-dutpase mutant enzyme variant e145q from methanocaldococcus jannaschii in complex with pyrophosphate and magnesium
PDB Compounds: (A:) dCTP deaminase, dUMP-forming

SCOPe Domain Sequences for d3gf0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gf0a_ b.85.4.1 (A:) automated matches {Methanocaldococcus jannaschii [TaxId: 2190]}
milsdkdiidyvtskriiikpfnkdfvgpcsydvtlgdefiiyddevydlskelnykrik
iknsilvcplnynlteekinyfkekynvdyvveggvlgttneyielpndisaqyqgrssl
grvfltshqtagwidagfkgkitlqivafdkpvilyknqrigqlifskllspadvgyser
ktskyayqksvmpslihld

SCOPe Domain Coordinates for d3gf0a_:

Click to download the PDB-style file with coordinates for d3gf0a_.
(The format of our PDB-style files is described here.)

Timeline for d3gf0a_: