Lineage for d3gemd_ (3gem D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848201Species Pseudomonas syringae [TaxId:264730] [225625] (1 PDB entry)
  8. 2848205Domain d3gemd_: 3gem D: [210514]
    automated match to d2c07a1
    complexed with act

Details for d3gemd_

PDB Entry: 3gem (more details), 1.83 Å

PDB Description: crystal structure of short-chain dehydrogenase from pseudomonas syringae
PDB Compounds: (D:) Short chain dehydrogenase

SCOPe Domain Sequences for d3gemd_:

Sequence, based on SEQRES records: (download)

>d3gemd_ c.2.1.0 (D:) automated matches {Pseudomonas syringae [TaxId: 264730]}
sapilitgasqrvglhcalrllehghrviisyrtehasvtelrqagavalygdfscetgi
mafidllktqtsslravvhnasewlaetpgeeadnftrmfsvhmlapylinlhcepllta
sevadivhisddvtrkgsskhiaycatkaglesltlsfaarfaplvkvngiapallmfqp
kddaayranalaksalgiepgaeviyqslrylldstyvtgttltvnggrhvk

Sequence, based on observed residues (ATOM records): (download)

>d3gemd_ c.2.1.0 (D:) automated matches {Pseudomonas syringae [TaxId: 264730]}
sapilitgasqrvglhcalrllehghrviisyrtehasvtelrqagavalygdfscetgi
mafidllktqtsslravvhnasewlaetpgeeadnftrmfsvhmlapylinlhcepllta
sevadivhisddvtrkgsskhiaycatkaglesltlsfaarfaplvkvngiapallmfqp
epgaeviyqslrylldstyvtgttltvnggrhvk

SCOPe Domain Coordinates for d3gemd_:

Click to download the PDB-style file with coordinates for d3gemd_.
(The format of our PDB-style files is described here.)

Timeline for d3gemd_: