| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (63 species) not a true protein |
| Species Staphylococcus aureus [TaxId:93062] [225611] (2 PDB entries) |
| Domain d3ge1d2: 3ge1 D:253-497 [210510] Other proteins in same PDB: d3ge1a3, d3ge1b3 automated match to d3ezwd2 complexed with adp, cl, gol, po4 |
PDB Entry: 3ge1 (more details), 2.7 Å
SCOPe Domain Sequences for d3ge1d2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ge1d2 c.55.1.0 (D:253-497) automated matches {Staphylococcus aureus [TaxId: 93062]}
acfergdvkntygtggfmlmntgdkavksesgllttiaygidgkvnyalegsifvsgsai
qwlrdglrminsapqsesyatrvdstegvyvvpafvglgtpywdseargaifgltrgtek
ehfiratleslcyqtrdvmeamskdsgidvqslrvdggavknnfimqfqadivntsverp
eiqettalgaaflaglavgfweskddiaknwkleekfdpkmdegereklyrgwkkaveat
qvfkt
Timeline for d3ge1d2: