Lineage for d3ge1d1 (3ge1 D:2-252)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885605Species Staphylococcus aureus [TaxId:93062] [225611] (2 PDB entries)
  8. 2885620Domain d3ge1d1: 3ge1 D:2-252 [210509]
    Other proteins in same PDB: d3ge1a3, d3ge1b3
    automated match to d1glfo1
    complexed with adp, cl, gol, po4

Details for d3ge1d1

PDB Entry: 3ge1 (more details), 2.7 Å

PDB Description: 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
PDB Compounds: (D:) glycerol kinase

SCOPe Domain Sequences for d3ge1d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ge1d1 c.55.1.0 (D:2-252) automated matches {Staphylococcus aureus [TaxId: 93062]}
ekyilsidqgttssrailfnqkgeiagvaqrefkqyfpqsgwvehdaneiwtsvlavmte
vinendvradqiagigitnqrettvvwdkhtgrpiyhaivwqsrqtqsicselkqqgyeq
tfrdktgllldpyfagtkvkwildnvegarekaengdllfgtidtwlvwklsgkaahitd
ysnasrtlmfnihdlewddellelltvpknmlpevkassevygktidyhfygqevpiagv
agdqqaalfgq

SCOPe Domain Coordinates for d3ge1d1:

Click to download the PDB-style file with coordinates for d3ge1d1.
(The format of our PDB-style files is described here.)

Timeline for d3ge1d1: