Lineage for d3ge1c2 (3ge1 C:253-497)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1372364Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1372365Superfamily c.55.1: Actin-like ATPase domain [53067] (15 families) (S)
    duplication contains two domains of this fold
  5. 1373353Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1373354Protein automated matches [226839] (35 species)
    not a true protein
  7. 1373669Species Staphylococcus aureus [TaxId:93062] [225611] (2 PDB entries)
  8. 1373683Domain d3ge1c2: 3ge1 C:253-497 [210508]
    automated match to d3ezwd2
    complexed with adp, cl, gol, po4

Details for d3ge1c2

PDB Entry: 3ge1 (more details), 2.7 Å

PDB Description: 2.7 angstrom crystal structure of glycerol kinase (glpk) from staphylococcus aureus in complex with adp and glycerol
PDB Compounds: (C:) glycerol kinase

SCOPe Domain Sequences for d3ge1c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ge1c2 c.55.1.0 (C:253-497) automated matches {Staphylococcus aureus [TaxId: 93062]}
acfergdvkntygtggfmlmntgdkavksesgllttiaygidgkvnyalegsifvsgsai
qwlrdglrminsapqsesyatrvdstegvyvvpafvglgtpywdseargaifgltrgtek
ehfiratleslcyqtrdvmeamskdsgidvqslrvdggavknnfimqfqadivntsverp
eiqettalgaaflaglavgfweskddiaknwkleekfdpkmdegereklyrgwkkaveat
qvfkt

SCOPe Domain Coordinates for d3ge1c2:

Click to download the PDB-style file with coordinates for d3ge1c2.
(The format of our PDB-style files is described here.)

Timeline for d3ge1c2: