| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) ![]() duplication contains two domains of this fold |
| Family c.55.1.0: automated matches [227137] (1 protein) not a true family |
| Protein automated matches [226839] (64 species) not a true protein |
| Species Staphylococcus aureus [TaxId:93062] [225611] (2 PDB entries) |
| Domain d3ge1b1: 3ge1 B:1-252 [210505] Other proteins in same PDB: d3ge1a3, d3ge1b3 automated match to d1glfo1 complexed with adp, cl, gol, po4 |
PDB Entry: 3ge1 (more details), 2.7 Å
SCOPe Domain Sequences for d3ge1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ge1b1 c.55.1.0 (B:1-252) automated matches {Staphylococcus aureus [TaxId: 93062]}
mekyilsidqgttssrailfnqkgeiagvaqrefkqyfpqsgwvehdaneiwtsvlavmt
evinendvradqiagigitnqrettvvwdkhtgrpiyhaivwqsrqtqsicselkqqgye
qtfrdktgllldpyfagtkvkwildnvegarekaengdllfgtidtwlvwklsgkaahit
dysnasrtlmfnihdlewddellelltvpknmlpevkassevygktidyhfygqevpiag
vagdqqaalfgq
Timeline for d3ge1b1: