SCOPe 2.05: Domain d3gdqa2: 3gdq A:193-384

Lineage for d3gdqa2 (3gdq A:193-384)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (49 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [224896] (42 PDB entries)

8. Domain d3gdqa2: 3gdq A:193-384 [210502]
   automated match to d1ngfa2
   complexed with adp, gol, mn, po4

Details for d3gdqa2

PDB Entry: 3gdq, 1.8 Å

PDB Description: Crystal structure of the human 70kDa heat shock protein 1-like ATPase domain in complex with ADP and inorganic phosphate

PDB Compounds: (A:) Heat shock 70 kDa protein 1-like

SCOPe Domain Sequences for d3gdqa2:

Sequence; same for both SEQRES and ATOM records:

>d3gdqa2 c.55.1.0 (A:193-384) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gerhvlifdlgggtfdvsiltiddgifevkatagdthlggedfdnrlvshfveefkrkhk
kdisqnkravrrlrtacerakrtlssstqanleidslyegidfytsitrarfeelcadlf
rgtlepvekalrdakmdkakihdivlvggstripkvqrllqdyfngrdlnksinpdeava
ygaavqaailmg

Timeline for d3gdqa2:

• d3gdqa2 first appeared in SCOPe 2.03
  
• d3gdqa2 appears in SCOPe 2.04
  
• d3gdqa2 appears in SCOPe 2.06
  
• d3gdqa2 appears in the current release, SCOPe 2.08