Lineage for d3gd5c1 (3gd5 C:10-153)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2906432Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 2906433Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 2906884Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 2906885Protein automated matches [226938] (26 species)
    not a true protein
  7. 2906957Species Gloeobacter violaceus [TaxId:251221] [225645] (1 PDB entry)
  8. 2906962Domain d3gd5c1: 3gd5 C:10-153 [210492]
    automated match to d1pvva1

Details for d3gd5c1

PDB Entry: 3gd5 (more details), 2.1 Å

PDB Description: crystal structure of ornithine carbamoyltransferase from gloeobacter violaceus
PDB Compounds: (C:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d3gd5c1:

Sequence, based on SEQRES records: (download)

>d3gd5c1 c.78.1.0 (C:10-153) automated matches {Gloeobacter violaceus [TaxId: 251221]}
trfrpdllslddldeaqlhalltlahqlkrgervanlhgkvlglvflkastrtrvsftva
myqlggqvidlspsntqvgrgepvrdtarvlgryvdglairtfaqteleeyahyagipvi
naltdhehpcqvvadlltirenfg

Sequence, based on observed residues (ATOM records): (download)

>d3gd5c1 c.78.1.0 (C:10-153) automated matches {Gloeobacter violaceus [TaxId: 251221]}
trfrpdllslddldeaqlhalltlahqlkrgervanlhgkvlglvflkastrtrvsftva
myqlggqvidlepvrdtarvlgryvdglairtfaqteleeyahyagipvinaltdhehpc
qvvadlltirenfg

SCOPe Domain Coordinates for d3gd5c1:

Click to download the PDB-style file with coordinates for d3gd5c1.
(The format of our PDB-style files is described here.)

Timeline for d3gd5c1: