SCOPe 2.05: Domain d3gd5b1: 3gd5 B:10-153

Lineage for d3gd5b1 (3gd5 B:10-153)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (22 species)
   not a true protein

7. Species Gloeobacter violaceus [TaxId:251221] [225645] (1 PDB entry)

8. Domain d3gd5b1: 3gd5 B:10-153 [210490]
   automated match to d1pvva1

Details for d3gd5b1

PDB Entry: 3gd5, 2.1 Å

PDB Description: crystal structure of ornithine carbamoyltransferase from gloeobacter violaceus

PDB Compounds: (B:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d3gd5b1:

Sequence, based on SEQRES records:

>d3gd5b1 c.78.1.0 (B:10-153) automated matches {Gloeobacter violaceus [TaxId: 251221]}
trfrpdllslddldeaqlhalltlahqlkrgervanlhgkvlglvflkastrtrvsftva
myqlggqvidlspsntqvgrgepvrdtarvlgryvdglairtfaqteleeyahyagipvi
naltdhehpcqvvadlltirenfg

Sequence, based on observed residues (ATOM records):

>d3gd5b1 c.78.1.0 (B:10-153) automated matches {Gloeobacter violaceus [TaxId: 251221]}
trfrpdllslddldeaqlhalltlahqlkrgervanlhgkvlglvflkastrtrvsftva
myqlggqvidlepvrdtarvlgryvdglairtfaqteleeyahyagipvinaltdhehpc
qvvadlltirenfg

Timeline for d3gd5b1:

• d3gd5b1 first appeared in SCOPe 2.03
  
• d3gd5b1 appears in SCOPe 2.04
  
• d3gd5b1 appears in SCOPe 2.06
  
• d3gd5b1 appears in the current release, SCOPe 2.08