Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
Protein automated matches [226938] (22 species) not a true protein |
Species Gloeobacter violaceus [TaxId:251221] [225645] (1 PDB entry) |
Domain d3gd5b1: 3gd5 B:10-153 [210490] automated match to d1pvva1 |
PDB Entry: 3gd5 (more details), 2.1 Å
SCOPe Domain Sequences for d3gd5b1:
Sequence, based on SEQRES records: (download)
>d3gd5b1 c.78.1.0 (B:10-153) automated matches {Gloeobacter violaceus [TaxId: 251221]} trfrpdllslddldeaqlhalltlahqlkrgervanlhgkvlglvflkastrtrvsftva myqlggqvidlspsntqvgrgepvrdtarvlgryvdglairtfaqteleeyahyagipvi naltdhehpcqvvadlltirenfg
>d3gd5b1 c.78.1.0 (B:10-153) automated matches {Gloeobacter violaceus [TaxId: 251221]} trfrpdllslddldeaqlhalltlahqlkrgervanlhgkvlglvflkastrtrvsftva myqlggqvidlepvrdtarvlgryvdglairtfaqteleeyahyagipvinaltdhehpc qvvadlltirenfg
Timeline for d3gd5b1: