![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
![]() | Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
![]() | Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins) |
![]() | Protein automated matches [226997] (13 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:602] [225624] (1 PDB entry) |
![]() | Domain d3gc2a2: 3gc2 A:100-320 [210486] Other proteins in same PDB: d3gc2a1, d3gc2a3 automated match to d1r6wa1 complexed with cl, epe, na, sin |
PDB Entry: 3gc2 (more details), 1.85 Å
SCOPe Domain Sequences for d3gc2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gc2a2 c.1.11.2 (A:100-320) automated matches {Salmonella typhimurium [TaxId: 602]} eaadyraaplctgdpddlvlrladmpgekiakvkvglyeavrdgmvvnllleaipdlhlr ldanrawtplkaqqfakyvnpdyrariafleepcktrddsrafaretgiaiawdeslrea dftfeaeegvravvikptltgsldkvreqvaaahalgltavisssiesslgltqlariaa wltpgtlpgldtlhlmqaqqirpwpgsalpclkreelerll
Timeline for d3gc2a2: