Lineage for d3gc2a2 (3gc2 A:100-320)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2836928Family c.1.11.2: D-glucarate dehydratase-like [51609] (15 proteins)
  6. 2837122Protein automated matches [226997] (13 species)
    not a true protein
  7. 2837237Species Salmonella typhimurium [TaxId:602] [225624] (1 PDB entry)
  8. 2837238Domain d3gc2a2: 3gc2 A:100-320 [210486]
    Other proteins in same PDB: d3gc2a1, d3gc2a3
    automated match to d1r6wa1
    complexed with cl, epe, na, sin

Details for d3gc2a2

PDB Entry: 3gc2 (more details), 1.85 Å

PDB Description: 1.85 angstrom crystal structure of o-succinylbenzoate synthase from salmonella typhimurium in complex with succinic acid
PDB Compounds: (A:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d3gc2a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gc2a2 c.1.11.2 (A:100-320) automated matches {Salmonella typhimurium [TaxId: 602]}
eaadyraaplctgdpddlvlrladmpgekiakvkvglyeavrdgmvvnllleaipdlhlr
ldanrawtplkaqqfakyvnpdyrariafleepcktrddsrafaretgiaiawdeslrea
dftfeaeegvravvikptltgsldkvreqvaaahalgltavisssiesslgltqlariaa
wltpgtlpgldtlhlmqaqqirpwpgsalpclkreelerll

SCOPe Domain Coordinates for d3gc2a2:

Click to download the PDB-style file with coordinates for d3gc2a2.
(The format of our PDB-style files is described here.)

Timeline for d3gc2a2: