SCOPe 2.06: Domain d3gc2a1: 3gc2 A:1-99

Lineage for d3gc2a1 (3gc2 A:1-99)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (88 species)
   not a true protein

7. Species Salmonella typhimurium [TaxId:602] [225623] (1 PDB entry)

8. Domain d3gc2a1: 3gc2 A:1-99 [210485]
   Other proteins in same PDB: d3gc2a2, d3gc2a3
   automated match to d1r6wa2
   complexed with cl, epe, na, sin

Details for d3gc2a1

PDB Entry: 3gc2, 1.85 Å

PDB Description: 1.85 angstrom crystal structure of o-succinylbenzoate synthase from salmonella typhimurium in complex with succinic acid

PDB Compounds: (A:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d3gc2a1:

Sequence; same for both SEQRES and ATOM records:

>d3gc2a1 d.54.1.0 (A:1-99) automated matches {Salmonella typhimurium [TaxId: 602]}
mrsaqvyrwqipmdagvvlrdrrlktrdglyvclrdgeregwgeisplpgfsqetweeaq
talltwvndwlqgseglpempsvafgascalaeltgvlp

Timeline for d3gc2a1:

• d3gc2a1 first appeared in SCOPe 2.03
  
• d3gc2a1 appears in SCOPe 2.05
  
• d3gc2a1 appears in SCOPe 2.07
  
• d3gc2a1 appears in the current release, SCOPe 2.08