Lineage for d3gc2a1 (3gc2 A:-1-99)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413260Species Salmonella typhimurium [TaxId:602] [225623] (1 PDB entry)
  8. 1413261Domain d3gc2a1: 3gc2 A:-1-99 [210485]
    Other proteins in same PDB: d3gc2a2
    automated match to d1r6wa2
    complexed with cl, epe, na, sin

Details for d3gc2a1

PDB Entry: 3gc2 (more details), 1.85 Å

PDB Description: 1.85 angstrom crystal structure of o-succinylbenzoate synthase from salmonella typhimurium in complex with succinic acid
PDB Compounds: (A:) o-succinylbenzoate synthase

SCOPe Domain Sequences for d3gc2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gc2a1 d.54.1.0 (A:-1-99) automated matches {Salmonella typhimurium [TaxId: 602]}
namrsaqvyrwqipmdagvvlrdrrlktrdglyvclrdgeregwgeisplpgfsqetwee
aqtalltwvndwlqgseglpempsvafgascalaeltgvlp

SCOPe Domain Coordinates for d3gc2a1:

Click to download the PDB-style file with coordinates for d3gc2a1.
(The format of our PDB-style files is described here.)

Timeline for d3gc2a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gc2a2