![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
![]() | Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
![]() | Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
![]() | Protein automated matches [226922] (55 species) not a true protein |
![]() | Species Salmonella typhimurium [TaxId:602] [225623] (1 PDB entry) |
![]() | Domain d3gc2a1: 3gc2 A:-1-99 [210485] Other proteins in same PDB: d3gc2a2 automated match to d1r6wa2 complexed with cl, epe, na, sin |
PDB Entry: 3gc2 (more details), 1.85 Å
SCOPe Domain Sequences for d3gc2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gc2a1 d.54.1.0 (A:-1-99) automated matches {Salmonella typhimurium [TaxId: 602]} namrsaqvyrwqipmdagvvlrdrrlktrdglyvclrdgeregwgeisplpgfsqetwee aqtalltwvndwlqgseglpempsvafgascalaeltgvlp
Timeline for d3gc2a1: