![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.0: automated matches [191359] (1 protein) not a true family |
![]() | Protein automated matches [190417] (37 species) not a true protein |
![]() | Species Giardia lamblia [TaxId:184922] [225636] (2 PDB entries) |
![]() | Domain d3gc0a_: 3gc0 A: [210484] automated match to d3blqa_ complexed with amp |
PDB Entry: 3gc0 (more details), 2 Å
SCOPe Domain Sequences for d3gc0a_:
Sequence, based on SEQRES records: (download)
>d3gc0a_ d.144.1.0 (A:) automated matches {Giardia lamblia [TaxId: 184922]} sidryrritklgegtygevykaidtvtnetvaikrirleheeegvpgtairevsllkelq hrniielksvihhnhrlhlifeyaendlkkymdknpdvsmrviksflyqlingvnfchsr rclhrdlkpqnlllsvsdasetpvlkigdfglarafgipirqftheiitlwyrppeillg srhystsvdiwsiaciwaemlmktplfpgdseidqlfkifevlglpddttwpgvtalpdw kqsfpkfrgktlkrvlgallddegldlltamlemdpvkrisaknalehpyfshndfdp
>d3gc0a_ d.144.1.0 (A:) automated matches {Giardia lamblia [TaxId: 184922]} sidryrritklgegtygevykaidtvtnetvaikrirlehtairevsllkelqhrniiel ksvihhnhrlhlifeyaendlkkymdknpdvsmrviksflyqlingvnfchsrrclhrdl kpqnlllsvetpvlkigdfglarafeiitlwyrppeillgsrhystsvdiwsiaciwaem lmktplfpgdseidqlfkifevlglpddttwpgvtalpdwkqsfpkfrgktlkrvlgall ddegldlltamlemdpvkrisaknalehpyfshndfdp
Timeline for d3gc0a_: