![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.72: Ribokinase-like [53612] (3 superfamilies) core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest potential superfamily: members of this fold have similar functions but different ATP-binding sites |
![]() | Superfamily c.72.1: Ribokinase-like [53613] (6 families) ![]() has extra strand located between strands 2 and 3 |
![]() | Family c.72.1.0: automated matches [191321] (1 protein) not a true family |
![]() | Protein automated matches [190117] (50 species) not a true protein |
![]() | Species Pyrococcus horikoshii OT3 [TaxId:70601] [225622] (1 PDB entry) |
![]() | Domain d3gbua1: 3gbu A:4-304 [210479] Other proteins in same PDB: d3gbua2, d3gbub2, d3gbuc2, d3gbud2 automated match to d2fv7a1 complexed with atp |
PDB Entry: 3gbu (more details), 2.2 Å
SCOPe Domain Sequences for d3gbua1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gbua1 c.72.1.0 (A:4-304) automated matches {Pyrococcus horikoshii OT3 [TaxId: 70601]} iasigellidlisveegdlkdvrlfekhpggapanvavgvsrlgvkssliskvgndpfge ylieelskenvdtrgivkdekkhtgivfvqlkgaspsfllyddvayfnmtlndinwdive eakivnfgsvilarnpsretvmkvikkikgssliafdvnlrldlwrgqeeemikvleesi kladivkaseeevlylenqgvevkgsmltaitlgpkgfrliknetvvdvpsynvnpldtt gagdafmaallvgilklkgldllklgkfanlvaalstqkrgawstprkdellkykearev l
Timeline for d3gbua1: