Lineage for d3gbba_ (3gbb A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2520986Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2520987Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2522523Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2522524Protein automated matches [190039] (158 species)
    not a true protein
  7. 2523133Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (113 PDB entries)
  8. 2523283Domain d3gbba_: 3gbb A: [210473]
    Other proteins in same PDB: d3gbbb2
    automated match to d1ycjb_
    complexed with ms8

Details for d3gbba_

PDB Entry: 3gbb (more details), 2.1 Å

PDB Description: x-ray structure of iglur5 ligand-binding core (s1s2) in complex with msviii-19 at 2.10a resolution
PDB Compounds: (A:) Glutamate receptor, ionotropic kainate 1

SCOPe Domain Sequences for d3gbba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gbba_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nrtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkyg
aqndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpids
addlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvlt
tdyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegk
lhmmkekwwrgngcp

SCOPe Domain Coordinates for d3gbba_:

Click to download the PDB-style file with coordinates for d3gbba_.
(The format of our PDB-style files is described here.)

Timeline for d3gbba_: