SCOPe 2.03: Domain d3gbba_: 3gbb A:

Lineage for d3gbba_ (3gbb A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (57 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186759] (69 PDB entries)

8. Domain d3gbba_: 3gbb A: [210473]
   automated match to d1ycjb_
   complexed with ms8

Details for d3gbba_

PDB Entry: 3gbb, 2.1 Å

PDB Description: x-ray structure of iglur5 ligand-binding core (s1s2) in complex with msviii-19 at 2.10a resolution

PDB Compounds: (A:) Glutamate receptor, ionotropic kainate 1

SCOPe Domain Sequences for d3gbba_:

Sequence; same for both SEQRES and ATOM records:

>d3gbba_ c.94.1.0 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
nrtlivttileepyvmyrksdkplygndrfegycldllkelsnilgflydvklvpdgkyg
aqndkgewngmvkelidhradlavapltityvrekvidfskpfmtlgisilyrkgtpids
addlakqtkieygavrdgstmtffkkskistyekmwafmssrqqsalvknsdegiqrvlt
tdyallmestsieyvtqrncnltqigglidskgygvgtpigspyrdkitiailqlqeegk
lhmmkekwwrgngcp

Timeline for d3gbba_:

• d3gbba_ is new in SCOPe 2.03-stable
  
• d3gbba_ appears in SCOPe 2.04
  
• d3gbba_ appears in the current release, SCOPe 2.08