Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Fab CNJ206 (mouse), kappa L chain [49012] (2 PDB entries) |
Domain d2gfbb2: 2gfb B:120-227 [21047] Other proteins in same PDB: d2gfba1, d2gfbb1, d2gfbc1, d2gfbd1, d2gfbe1, d2gfbf1, d2gfbg1, d2gfbh1, d2gfbi1, d2gfbj1, d2gfbk1, d2gfbl1, d2gfbm1, d2gfbn1, d2gfbo1, d2gfbp1 |
PDB Entry: 2gfb (more details), 3 Å
SCOP Domain Sequences for d2gfbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2gfbb2 b.1.1.2 (B:120-227) Immunoglobulin (constant domains of L and H chains) {Fab CNJ206 (mouse), kappa L chain} svyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdlytlss svtvtsstwpsqsitcnvahpasstkvdkkieprg
Timeline for d2gfbb2:
View in 3D Domains from other chains: (mouse over for more information) d2gfba1, d2gfba2, d2gfbc1, d2gfbc2, d2gfbd1, d2gfbd2, d2gfbe1, d2gfbe2, d2gfbf1, d2gfbf2, d2gfbg1, d2gfbg2, d2gfbh1, d2gfbh2, d2gfbi1, d2gfbi2, d2gfbj1, d2gfbj2, d2gfbk1, d2gfbk2, d2gfbl1, d2gfbl2, d2gfbm1, d2gfbm2, d2gfbn1, d2gfbn2, d2gfbo1, d2gfbo2, d2gfbp1, d2gfbp2 |