SCOPe 2.03: Domain d3gb9c_: 3gb9 C:

Lineage for d3gb9c_ (3gb9 C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
   core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops

4. Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families)
   complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8

5. Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 proteins)

6. Protein Purine nucleoside phosphorylase, PNP [53169] (12 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53170] (29 PDB entries)
   Uniprot P00491

8. Domain d3gb9c_: 3gb9 C: [210468]
   automated match to d3bgsa_
   complexed with a2f, gol, so4; mutant

Details for d3gb9c_

PDB Entry: 3gb9, 2.3 Å

PDB Description: human purine nucleoside phosphorylase double mutant e201q,n243d complexed with 2-fluoroadenine

PDB Compounds: (C:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d3gb9c_:

Sequence, based on SEQRES records:

>d3gb9c_ c.56.2.1 (C:) Purine nucleoside phosphorylase, PNP {Human (Homo sapiens) [TaxId: 9606]}
mengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdygeipnfprst
vpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggl
npkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkq
mgeqrelqegtyvmvagpsfqtvaecrvlqklgadavgmstvpevivarhcglrvfgfsl
itdkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplp

Sequence, based on observed residues (ATOM records):

>d3gb9c_ c.56.2.1 (C:) Purine nucleoside phosphorylase, PNP {Human (Homo sapiens) [TaxId: 9606]}
mengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdygeipnfprst
agrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaagglnpkf
evgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkqmgeq
relqegtyvmvagpsfqtvaecrvlqklgadavgmstvpevivarhcglrvfgfslitdk
vimdyesvlaagkqaaqkleqfvsilmasiplp

Timeline for d3gb9c_:

• d3gb9c_ is new in SCOPe 2.03-stable
  
• d3gb9c_ appears in SCOPe 2.04
  
• d3gb9c_ appears in the current release, SCOPe 2.08