Lineage for d3gb9b1 (3gb9 B:1-285)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2125386Fold c.56: Phosphorylase/hydrolase-like [53162] (8 superfamilies)
    core: 3 layers, a/b/a ; mixed sheet of 5 strands: order 21354; strand 4 is antiparallel to the rest; contains crossover loops
  4. 2125403Superfamily c.56.2: Purine and uridine phosphorylases [53167] (2 families) (S)
    complex architecture; contains mixed beta-sheet of 8 strands, order 23415867, strands 3, 6 & 7 are antiparallel to the rest; and barrel, closed; n=5, S=8
  5. 2125404Family c.56.2.1: Purine and uridine phosphorylases [53168] (7 protein domains)
  6. 2125514Protein Purine nucleoside phosphorylase, PNP [53169] (13 species)
  7. 2125692Species Human (Homo sapiens) [TaxId:9606] [53170] (29 PDB entries)
    Uniprot P00491
  8. 2125695Domain d3gb9b1: 3gb9 B:1-285 [210467]
    Other proteins in same PDB: d3gb9b2
    automated match to d3bgsa_
    complexed with a2f, gol, so4; mutant

Details for d3gb9b1

PDB Entry: 3gb9 (more details), 2.3 Å

PDB Description: human purine nucleoside phosphorylase double mutant e201q,n243d complexed with 2-fluoroadenine
PDB Compounds: (B:) purine nucleoside phosphorylase

SCOPe Domain Sequences for d3gb9b1:

Sequence, based on SEQRES records: (download)

>d3gb9b1 c.56.2.1 (B:1-285) Purine nucleoside phosphorylase, PNP {Human (Homo sapiens) [TaxId: 9606]}
mengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdygeipnfprst
vpghagrlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaaggl
npkfevgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkq
mgeqrelqegtyvmvagpsfqtvaecrvlqklgadavgmstvpevivarhcglrvfgfsl
itdkvimdyeslekanheevlaagkqaaqkleqfvsilmasiplp

Sequence, based on observed residues (ATOM records): (download)

>d3gb9b1 c.56.2.1 (B:1-285) Purine nucleoside phosphorylase, PNP {Human (Homo sapiens) [TaxId: 9606]}
mengytyedykntaewllshtkhrpqvaiicgsglggltdkltqaqifdygeipnfprst
grlvfgflngracvmmqgrfhmyegyplwkvtfpvrvfhllgvdtlvvtnaagglnpkfe
vgdimlirdhinlpgfsgqnplrgpnderfgdrfpamsdaydrtmrqralstwkqmgeqr
elqegtyvmvagpsfqtvaecrvlqklgadavgmstvpevivarhcglrvfgfslitdkv
imdyeagkqaaqkleqfvsilmasiplp

SCOPe Domain Coordinates for d3gb9b1:

Click to download the PDB-style file with coordinates for d3gb9b1.
(The format of our PDB-style files is described here.)

Timeline for d3gb9b1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3gb9b2