SCOPe 2.06: Domain d3gb3b_: 3gb3 B:

Lineage for d3gb3b_ (3gb3 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.22: GFP-like [54510] (1 superfamily)
   beta-sheet folds into a barrel (n=11, S=14) around the central helix

4. Superfamily d.22.1: GFP-like [54511] (3 families)

5. Family d.22.1.0: automated matches [191400] (1 protein)
   not a true family

6. Protein automated matches [190526] (21 species)
   not a true protein

7. Species Anthomedusae sp. [TaxId:328397] [194158] (5 PDB entries)

8. Domain d3gb3b_: 3gb3 B: [210460]
   automated match to d3gl4b_
   complexed with so4

Details for d3gb3b_

PDB Entry: 3gb3, 1.75 Å

PDB Description: x-ray structure of genetically encoded photosensitizer killerred in native form

PDB Compounds: (B:) KillerRed

SCOPe Domain Sequences for d3gb3b_:

Sequence; same for both SEQRES and ATOM records:

>d3gb3b_ d.22.1.0 (B:) automated matches {Anthomedusae sp. [TaxId: 328397]}
eggpalfqsdmtfkifidgevngqkftivadgsskfphgdfnvhavcetgklpmswkpic
hliqygepffarypdgishfaqecfpeglsidrtvrfendgtmtshhtyelddtcvvsri
tvncdgfqpdgpimrdqlvdilpnethmfphgpnavrqlafigfttadgglmmghfdskm
tfngsraieipgphfvtiitkqmrdtsdkrdhvcqrevayahsvpritsaig

Timeline for d3gb3b_:

• d3gb3b_ first appeared in SCOPe 2.03
  
• d3gb3b_ appears in SCOPe 2.05
  
• d3gb3b_ appears in SCOPe 2.07
  
• d3gb3b_ appears in the current release, SCOPe 2.08