| Class h: Coiled coil proteins [57942] (7 folds) |
| Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) ![]() |
| Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins) |
| Protein Surfactant protein [57949] (3 species) |
| Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries) |
| Domain d3g84c2: 3g84 C:205-234 [210456] Other proteins in same PDB: d3g84a1, d3g84b1, d3g84c1 complexed with ca; mutant |
PDB Entry: 3g84 (more details), 2.3 Å
SCOPe Domain Sequences for d3g84c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g84c2 h.1.1.1 (C:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf
Timeline for d3g84c2:
View in 3DDomains from other chains: (mouse over for more information) d3g84a1, d3g84a2, d3g84b1, d3g84b2 |