Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (13 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (65 PDB entries) |
Domain d3g84c1: 3g84 C:235-355 [210455] Other proteins in same PDB: d3g84a2, d3g84b2, d3g84c2 complexed with ca; mutant |
PDB Entry: 3g84 (more details), 2.3 Å
SCOPe Domain Sequences for d3g84c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g84c1 d.169.1.0 (C:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]} pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndvacgekrlvvce f
Timeline for d3g84c1:
View in 3D Domains from other chains: (mouse over for more information) d3g84a1, d3g84a2, d3g84b1, d3g84b2 |