Lineage for d3g84b2 (3g84 B:205-234)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3039232Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family) (S)
  5. 3039233Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)
  6. 3039305Protein Surfactant protein [57949] (3 species)
  7. 3039306Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (26 PDB entries)
  8. 3039377Domain d3g84b2: 3g84 B:205-234 [210454]
    Other proteins in same PDB: d3g84a1, d3g84b1, d3g84c1
    complexed with ca; mutant

Details for d3g84b2

PDB Entry: 3g84 (more details), 2.3 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of r343v mutant of human surfactant protein d in complex with alpha 1,2 dimannose.
PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d3g84b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g84b2 h.1.1.1 (B:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf

SCOPe Domain Coordinates for d3g84b2:

Click to download the PDB-style file with coordinates for d3g84b2.
(The format of our PDB-style files is described here.)

Timeline for d3g84b2: