SCOP 1.61: Domain d1forh2: 1for H:121-219

Lineage for d1forh2 (1for H:121-219)

1. Root: SCOP 1.61

2. Class b: All beta proteins [48724] (111 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)

7. Species Fab 17-Ia (mouse), kappa L chain [49011] (1 PDB entry)

8. Domain d1forh2: 1for H:121-219 [21045]
   Other proteins in same PDB: d1forh1, d1forl1

Details for d1forh2

PDB Entry: 1for, 2.75 Å

PDB Description: structure determination of an fab fragment that neutralizes human rhinovirus and analysis of the fab-virus complex

SCOP Domain Sequences for d1forh2:

Sequence; same for both SEQRES and ATOM records:

>d1forh2 b.1.1.2 (H:121-219) Immunoglobulin (constant domains of L and H chains) {Fab 17-Ia (mouse), kappa L chain}
kttapsvyplapvcggttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsgl
ytlsssvtvtsstwpsqtitcnvahpasstkvdkkiepr

Timeline for d1forh2:

• d1forh2 first appeared (with stable ids) in SCOP 1.55
  
• d1forh2 appears in SCOP 1.59
  
• d1forh2 appears in SCOP 1.63
  
• d1forh2 appears in the current release, SCOPe 2.08