Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries) |
Domain d3g81c1: 3g81 C:235-355 [210443] Other proteins in same PDB: d3g81a2, d3g81b2, d3g81c2 complexed with ca, mma |
PDB Entry: 3g81 (more details), 1.8 Å
SCOPe Domain Sequences for d3g81c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g81c1 d.169.1.0 (C:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]} pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce f
Timeline for d3g81c1:
View in 3D Domains from other chains: (mouse over for more information) d3g81a1, d3g81a2, d3g81b1, d3g81b2 |