SCOPe 2.03: Domain d3g81b2: 3g81 B:205-234

Lineage for d3g81b2 (3g81 B:205-234)

1. Root: SCOPe 2.03

2. Class h: Coiled coil proteins [57942] (7 folds)

3. Fold h.1: Parallel coiled-coil [57943] (34 superfamilies)
   this is not a true fold; includes oligomers of shorter identical helices

4. Superfamily h.1.1: Triple coiled coil domain of C-type lectins [57944] (1 family)

5. Family h.1.1.1: Triple coiled coil domain of C-type lectins [57945] (3 proteins)

6. Protein Surfactant protein [57949] (2 species)

7. Species Human (Homo sapiens), SP-D [TaxId:9606] [57950] (24 PDB entries)

8. Domain d3g81b2: 3g81 B:205-234 [210442]
   Other proteins in same PDB: d3g81a1, d3g81b1, d3g81c1
   complexed with ca, mma

Details for d3g81b2

PDB Entry: 3g81, 1.8 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with alpha methyl mannoside

PDB Compounds: (B:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d3g81b2:

Sequence; same for both SEQRES and ATOM records:

>d3g81b2 h.1.1.1 (B:205-234) Surfactant protein {Human (Homo sapiens), SP-D [TaxId: 9606]}
aslrqqvealqgqvqhlqaafsqykkvelf

Timeline for d3g81b2:

• d3g81b2 is new in SCOPe 2.03-stable
  
• d3g81b2 appears in SCOPe 2.04
  
• d3g81b2 appears in the current release, SCOPe 2.08