Lineage for d3g81a1 (3g81 A:235-355)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2607278Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2607279Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2608201Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 2608202Protein automated matches [190159] (20 species)
    not a true protein
  7. 2608257Species Human (Homo sapiens) [TaxId:9606] [186882] (106 PDB entries)
  8. 2608396Domain d3g81a1: 3g81 A:235-355 [210439]
    Other proteins in same PDB: d3g81a2, d3g81b2, d3g81c2
    complexed with ca, mma

Details for d3g81a1

PDB Entry: 3g81 (more details), 1.8 Å

PDB Description: crystal structure of the trimeric neck and carbohydrate recognition domain of human surfactant protein d in complex with alpha methyl mannoside
PDB Compounds: (A:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d3g81a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g81a1 d.169.1.0 (A:235-355) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d3g81a1:

Click to download the PDB-style file with coordinates for d3g81a1.
(The format of our PDB-style files is described here.)

Timeline for d3g81a1: