SCOPe 2.08: Domain d3g7kd2: 3g7k D:171-380

Lineage for d3g7kd2 (3g7k D:171-380)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
   mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix

4. Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families)
   duplication: consists of two similar domain swapped with C-terminal strands

5. Family d.21.1.0: automated matches [191386] (1 protein)
   not a true family

6. Protein automated matches [190491] (18 species)
   not a true protein

7. Species Eubacterium barkeri [TaxId:1528] [225714] (1 PDB entry)

8. Domain d3g7kd2: 3g7k D:171-380 [210438]
   Other proteins in same PDB: d3g7kb3
   automated match to d2h9fa2

Details for d3g7kd2

PDB Entry: 3g7k, 2.7 Å

PDB Description: Crystal Structure of Methylitaconate-delta-isomerase

PDB Compounds: (D:) 3-methylitaconate isomerase

SCOPe Domain Sequences for d3g7kd2:

Sequence; same for both SEQRES and ATOM records:

>d3g7kd2 d.21.1.0 (D:171-380) automated matches {Eubacterium barkeri [TaxId: 1528]}
gaatgkvlptgnvvdvlstskgdidvsivdvanpcifvhakdvnmtgtetpdvingnadl
layleeirakccvkigmaatekeasekspafpmiafvtkpedyvdfstgntisgddvdlv
srlmfmqvlhktyagtatactgsaaripgtivnqvlrdtgdedtvrighpagvipvvsiv
kdgkvekaalirtarrimegyvyvekaklv

Timeline for d3g7kd2:

• d3g7kd2 first appeared in SCOPe 2.03
  
• d3g7kd2 appears in SCOPe 2.07