Lineage for d3g7kb1 (3g7k B:2-170)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2939535Fold d.21: Diaminopimelate epimerase-like [54505] (1 superfamily)
    mixed beta-sheet folds into a barrel (n=8, S=14) around the central helix
  4. 2939536Superfamily d.21.1: Diaminopimelate epimerase-like [54506] (5 families) (S)
    duplication: consists of two similar domain swapped with C-terminal strands
  5. 2939665Family d.21.1.0: automated matches [191386] (1 protein)
    not a true family
  6. 2939666Protein automated matches [190491] (18 species)
    not a true protein
  7. 2939699Species Eubacterium barkeri [TaxId:1528] [225714] (1 PDB entry)
  8. 2939702Domain d3g7kb1: 3g7k B:2-170 [210433]
    Other proteins in same PDB: d3g7kb3
    automated match to d2h9fa1

Details for d3g7kb1

PDB Entry: 3g7k (more details), 2.7 Å

PDB Description: Crystal Structure of Methylitaconate-delta-isomerase
PDB Compounds: (B:) 3-methylitaconate isomerase

SCOPe Domain Sequences for d3g7kb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g7kb1 d.21.1.0 (B:2-170) automated matches {Eubacterium barkeri [TaxId: 1528]}
sdqmripcvimragtskgiflkgndlpadqelrdkvilrifgspdvrqidglagadplts
klaiigpsthpdadvdytfaqvsitdavvdyngncgnisagvgpfaidesfvkavepmtr
vcihntntgkllyaevevedgkakvsgdckidgvpgtnapelmdfsdta

SCOPe Domain Coordinates for d3g7kb1:

Click to download the PDB-style file with coordinates for d3g7kb1.
(The format of our PDB-style files is described here.)

Timeline for d3g7kb1: