| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Anopheles dirus [TaxId:7168] [226778] (2 PDB entries) |
| Domain d3g7jb1: 3g7j B:1-90 [210429] Other proteins in same PDB: d3g7ja2, d3g7jb2 automated match to d1r5aa2 complexed with gtx |
PDB Entry: 3g7j (more details), 2.2 Å
SCOPe Domain Sequences for d3g7jb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g7jb1 c.47.1.0 (B:1-90) automated matches {Anopheles dirus [TaxId: 7168]}
mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
fvlwesraiqiylvekygahdadlaerlyp
Timeline for d3g7jb1: