Class a: All alpha proteins [46456] (289 folds) |
Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) this domains follows the thioredoxin-like N-terminal domain |
Family a.45.1.0: automated matches [227130] (1 protein) not a true family |
Protein automated matches [226831] (61 species) not a true protein |
Species Anopheles dirus [TaxId:7168] [226779] (2 PDB entries) |
Domain d3g7ja2: 3g7j A:91-217 [210428] Other proteins in same PDB: d3g7ja1, d3g7jb1 automated match to d1r5aa1 complexed with gtx |
PDB Entry: 3g7j (more details), 2.2 Å
SCOPe Domain Sequences for d3g7ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g7ja2 a.45.1.0 (A:91-217) automated matches {Anopheles dirus [TaxId: 7168]} sdprrravvhqrlffdvavlyqrfaeyyepqifgqkvpvgdpgrlrsmeqaleflntfle geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak vfgryft
Timeline for d3g7ja2: