Lineage for d3g7ja2 (3g7j A:91-217)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2713795Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2713796Protein automated matches [226831] (73 species)
    not a true protein
  7. 2713818Species Anopheles dirus [TaxId:7168] [226779] (2 PDB entries)
  8. 2713821Domain d3g7ja2: 3g7j A:91-217 [210428]
    Other proteins in same PDB: d3g7ja1, d3g7jb1
    automated match to d1r5aa1
    complexed with gtx

Details for d3g7ja2

PDB Entry: 3g7j (more details), 2.2 Å

PDB Description: crystal structure of a genetically modified delta class gst (adgstd4- 4) from anopheles dirus, y119e, in complex with s-hexyl glutathione
PDB Compounds: (A:) glutathione transferase GST1-4

SCOPe Domain Sequences for d3g7ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g7ja2 a.45.1.0 (A:91-217) automated matches {Anopheles dirus [TaxId: 7168]}
sdprrravvhqrlffdvavlyqrfaeyyepqifgqkvpvgdpgrlrsmeqaleflntfle
geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak
vfgryft

SCOPe Domain Coordinates for d3g7ja2:

Click to download the PDB-style file with coordinates for d3g7ja2.
(The format of our PDB-style files is described here.)

Timeline for d3g7ja2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g7ja1