Lineage for d3g7ib2 (3g7i B:91-213)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713031Protein Class delta GST [81355] (6 species)
    formerly a part of class theta enzymes
  7. 2713035Species Anopheles dirus [TaxId:7168] [224848] (2 PDB entries)
  8. 2713039Domain d3g7ib2: 3g7i B:91-213 [210426]
    Other proteins in same PDB: d3g7ia1, d3g7ib1
    automated match to d1jlwa1
    complexed with gsh

Details for d3g7ib2

PDB Entry: 3g7i (more details), 2.05 Å

PDB Description: crystal structure of a delta class gst (adgstd4-4) from anopheles dirus, with glutathione complexed in one subunit
PDB Compounds: (B:) glutathione transferase GST1-4

SCOPe Domain Sequences for d3g7ib2:

Sequence, based on SEQRES records: (download)

>d3g7ib2 a.45.1.1 (B:91-213) Class delta GST {Anopheles dirus [TaxId: 7168]}
sdprrravvhqrlffdvavlyqrfaeyyypqifgqkvpvgdpgrlrsmeqaleflntfle
geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak
vfg

Sequence, based on observed residues (ATOM records): (download)

>d3g7ib2 a.45.1.1 (B:91-213) Class delta GST {Anopheles dirus [TaxId: 7168]}
sdprrravvhqrlffdvavlyqrfaeyyypdpgrlrsmeqaleflntflegeqyvaggdd
ptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegakvfg

SCOPe Domain Coordinates for d3g7ib2:

Click to download the PDB-style file with coordinates for d3g7ib2.
(The format of our PDB-style files is described here.)

Timeline for d3g7ib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g7ib1