SCOPe 2.08: Domain d3g7ib2: 3g7i B:91-213

Lineage for d3g7ib2 (3g7i B:91-213)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class delta GST [81355] (6 species)
   formerly a part of class theta enzymes

7. Species Anopheles dirus [TaxId:7168] [224848] (2 PDB entries)

8. Domain d3g7ib2: 3g7i B:91-213 [210426]
   Other proteins in same PDB: d3g7ia1, d3g7ib1
   automated match to d1jlwa1
   complexed with gsh

Details for d3g7ib2

PDB Entry: 3g7i, 2.05 Å

PDB Description: crystal structure of a delta class gst (adgstd4-4) from anopheles dirus, with glutathione complexed in one subunit

PDB Compounds: (B:) glutathione transferase GST1-4

SCOPe Domain Sequences for d3g7ib2:

Sequence, based on SEQRES records:

>d3g7ib2 a.45.1.1 (B:91-213) Class delta GST {Anopheles dirus [TaxId: 7168]}
sdprrravvhqrlffdvavlyqrfaeyyypqifgqkvpvgdpgrlrsmeqaleflntfle
geqyvaggddptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegak
vfg

Sequence, based on observed residues (ATOM records):

>d3g7ib2 a.45.1.1 (B:91-213) Class delta GST {Anopheles dirus [TaxId: 7168]}
sdprrravvhqrlffdvavlyqrfaeyyypdpgrlrsmeqaleflntflegeqyvaggdd
ptiadlsilatiatyevagydlrryenvqrwyertsaivpgadknvegakvfg

Timeline for d3g7ib2:

• d3g7ib2 first appeared in SCOPe 2.03
  
• d3g7ib2 appears in SCOPe 2.07