Lineage for d3g7ia1 (3g7i A:1-90)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1368269Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1368270Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1368661Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 1368841Protein Class delta GST [81366] (6 species)
    formerly a part of class theta enzymes
  7. 1368845Species Anopheles dirus [TaxId:7168] [224892] (2 PDB entries)
  8. 1368848Domain d3g7ia1: 3g7i A:1-90 [210423]
    Other proteins in same PDB: d3g7ia2, d3g7ib2
    automated match to d1jlwa2
    complexed with gsh

Details for d3g7ia1

PDB Entry: 3g7i (more details), 2.05 Å

PDB Description: crystal structure of a delta class gst (adgstd4-4) from anopheles dirus, with glutathione complexed in one subunit
PDB Compounds: (A:) glutathione transferase GST1-4

SCOPe Domain Sequences for d3g7ia1:

Sequence, based on SEQRES records: (download)

>d3g7ia1 c.47.1.5 (A:1-90) Class delta GST {Anopheles dirus [TaxId: 7168]}
mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
fvlwesraiqiylvekygahdadlaerlyp

Sequence, based on observed residues (ATOM records): (download)

>d3g7ia1 c.47.1.5 (A:1-90) Class delta GST {Anopheles dirus [TaxId: 7168]}
mdfyylpgsapcravqmtaaavgvelnlkltnlmagenpqhciptlvdedgfvlwesrai
qiylvekygahdadlaerlyp

SCOPe Domain Coordinates for d3g7ia1:

Click to download the PDB-style file with coordinates for d3g7ia1.
(The format of our PDB-style files is described here.)

Timeline for d3g7ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3g7ia2